PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010558285.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 282aa    MW: 30868.3 Da    PI: 9.9145
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010558285.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.9e-144286147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
   XP_010558285.1 42 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 86
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-173692IPR009057Homeodomain-like
PROSITE profilePS5129416.2913791IPR017930Myb domain
TIGRFAMsTIGR015578.1E-194089IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.5E-74092IPR009057Homeodomain-like
SMARTSM007171.1E-114189IPR001005SANT/Myb domain
PfamPF002496.5E-124286IPR001005SANT/Myb domain
CDDcd001671.96E-94487No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MNSSPPANPS ASQAPPPTTS TDVAEEGSTK KVRKPYTITK SRESWTEEEH DKFLEALQLF  60
DRDWKKIEDF VGSKTVIQIR SHAQKYFLKV QKNGTVAHVP PPRPKRKAAH PYPQKASKNA  120
QVLLHVSSPL PSPSSTLLGY APLDGSSALI NIGSTRVVLP QDELATLRGA EGMGSISRTL  180
SSSKILIQGK QAPVLHGVPD FAEVYNFIGS VFDPETKGHV RKLKEMDPIN FETVLLLMRN  240
LAINLSSPDF EPVRKVLLSY EVNTKLVAGS AESMVKTTDV SS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010558284.10.0PREDICTED: protein REVEILLE 8-like isoform X1
RefseqXP_010558285.10.0PREDICTED: protein REVEILLE 8-like isoform X2
SwissprotQ8RWU31e-141RVE8_ARATH; Protein REVEILLE 8
TrEMBLD7L8A71e-141D7L8A7_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.3__982__AT3G09600.11e-140(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.11e-116MYB_related family protein